PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I01703.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28174 Da    PI: 7.0452
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I01703.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.85.9e-281059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rienk+ rqvtf+kRrng+lKKA+ELS+LCdaeva+++fs+ g+ly +ss
  Pahal.I01703.1 10 RIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSS 59
                    9***********************************************96 PP

2K-box96.93.1e-32831749100
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      ++ ++++ +qe+ kLk ++e Lq++qR+llGedL +L+  eL qLe+q++k lk+iRs+K+++ll+++ +l++ke++lq++n+ L++kl+e
  Pahal.I01703.1  83 PSSDEMQNNYQEYVKLKTRVEVLQHSQRNLLGEDLAPLTTSELDQLESQVDKTLKQIRSRKTQVLLDELCDLKRKEHMLQDANRVLKRKLDE 174
                     567889***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.02161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-36160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-30284IPR002100Transcription factor, MADS-box
CDDcd002654.99E-41279No hitNo description
PRINTSPR004045.0E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-2885172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.09788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGKVVLQR IENKISRQVT FAKRRNGLLK KAYELSILCD AEVALVLFSH AGRLYQFSSS  60
SNLLKTLERY QRYIYASADA AVPSSDEMQN NYQEYVKLKT RVEVLQHSQR NLLGEDLAPL  120
TTSELDQLES QVDKTLKQIR SRKTQVLLDE LCDLKRKEHM LQDANRVLKR KLDEVEAEAP  180
PPPQPQLPWQ GGSGDDAMVS DGPPQPEHFF QALESNPSLQ PTFHTVDMNQ QPVPAPGGCY  240
PPAWSAWMA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A9e-25751721101Developmental protein SEPALLATA 3
4ox0_B9e-25751721101Developmental protein SEPALLATA 3
4ox0_C9e-25751721101Developmental protein SEPALLATA 3
4ox0_D9e-25751721101Developmental protein SEPALLATA 3
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6616140.0JN661614.1 Panicum miliaceum panicle phytomer 2-like protein (PAP2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981738.11e-160PREDICTED: MADS-box transcription factor 34
RefseqXP_004981739.11e-160PREDICTED: MADS-box transcription factor 34
SwissprotQ6Q9H61e-125MAD34_ORYSJ; MADS-box transcription factor 34
TrEMBLK4AE901e-160K4AE90_SETIT; Uncharacterized protein
STRINGSi037197m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136182630
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.15e-83MIKC_MADS family protein